You have no items in your shopping cart.
UBQLN1 Rabbit Polyclonal Antibody
Description
Research Area
Images & Validation
−| Tested Applications | IHC, WB |
|---|---|
| Reactivity | Human |
| Predicted Reactivity | Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat, Sheep, Zebrafish |
Key Properties
−| Host | Rabbit |
|---|---|
| Clonality | Polyclonal |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human UBQLN1 |
| Target | UBQLN1 |
| Protein Sequence | Synthetic peptide located within the following region: QFGGNPFASLVSNTSSGEGSQPSRTENRDPLPNPWAPQTSQSSSASSGTA |
| Molecular Weight | 62kDa |
| Purification | Affinity Purified |
| Conjugation | Unconjugated |
Storage & Handling
−| Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
|---|---|
| Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Concentration | 0.5 mg/ml |
| Expiration Date | 12 months from date of receipt. |
| Disclaimer | For research use only |
Alternative Names
−Similar Products
−UBQLN1 Antibody [orb1287619]
IHC
Human, Mouse, Rat
Rabbit
Polyclonal
Unconjugated

Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

Anti-UBQLN1 antibody IHC of human brain, cortex. Immunohistochemistry of formalin-fixed, paraffin-embedded tissue after heat-induced antigen retrieval. UBQLN1 Antibody orb582568 concentration 5 ug/ml.

Anti-UBQLN1 antibody IHC of human prostate. Immunohistochemistry of formalin-fixed, paraffin-embedded tissue after heat-induced antigen retrieval. UBQLN1 Antibody orb582568 concentration 5 ug/ml.

Immunohistochemistry with Human Lung, respiratory epethelium tissue at an antibody concentration of 5.0 ug/ml using anti-UBQLN1 antibody (orb582568).

WB Suggested Anti-UBQLN1 Antibody Titration: 1 ug/ml, Positive Control: 293T cells lysate.
Documents Download
Request a Document
Protocol Information
UBQLN1 Rabbit Polyclonal Antibody (orb582568)
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a Review



