UBQLN1 Rabbit Polyclonal Antibody

• Catalog Number: orb582568
• Category: Antibodies
• Description: Rabbit polyclonal antibody to UBQLN1
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: IHC, WB
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat, Sheep, Zebrafish
• Reactivity: Human
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human UBQLN1
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 62kDa
• Target: UBQLN1
• UniProt ID: Q5T6J9
• Protein Sequence: Synthetic peptide located within the following region: QFGGNPFASLVSNTSSGEGSQPSRTENRDPLPNPWAPQTSQSSSASSGTA
• NCBI: NP_038466
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: DA41, DSK2, UBQN, XDRP1, PLIC-1
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Anti-UBQLN1 antibody IHC of human brain, cortex. Immunohistochemistry of formalin-fixed, paraffin-embedded tissue after heat-induced antigen retrieval. UBQLN1 Antibody orb582568 concentration 5 ug/ml.

Anti-UBQLN1 antibody IHC of human prostate. Immunohistochemistry of formalin-fixed, paraffin-embedded tissue after heat-induced antigen retrieval. UBQLN1 Antibody orb582568 concentration 5 ug/ml.

Immunohistochemistry with Human Lung, respiratory epethelium tissue at an antibody concentration of 5.0 ug/ml using anti-UBQLN1 antibody (orb582568).

WB Suggested Anti-UBQLN1 Antibody Titration: 1 ug/ml, Positive Control: 293T cells lysate.