UBE3A Rabbit Polyclonal Antibody

• Catalog Number: orb578661
• Category: Antibodies
• Description: Rabbit polyclonal antibody to UBE3A
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: WB
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Rabbit, Rat, Zebrafish
• Reactivity: Human, Mouse
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human UBE3A
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 101kDa
• Target: UBE3A
• UniProt ID: Q05086
• Protein Sequence: Synthetic peptide located within the following region: AKNGPDTERLPTSHTCFNVLLLPEYSSKEKLKERLLKAITYAKGFGML
• NCBI: NP_000453
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: AS, ANCR, E6-AP, HPVE6A, EPVE6AP
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Sample Tissue: Mouse Kidney, Antibody Dilution: 1 ug/ml.

Sample Tissue: Mouse Kidney, Antibody Dilution: 1 ug/ml.

Lanes: Lane 1: 7 ug HeLa lysate+EGFP SiRNA, Lane 2: 7 ug HeLa lysate+UBE3A SiRNA, Primary Antibody Dilution: 1:300, Secondary Antibody: Anti-rabbit-HRP, Secondary Antibody Dilution: 1:500, Gene Name: UBE3A.

WB Suggested Anti-UBE3A Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:312500, Positive Control: Hela cell lysate. UBE3A is strongly supported by BioGPS gene expression data to be expressed in Human HeLa cells.