UBE2N Rabbit Polyclonal Antibody

• Catalog Number: orb574929
• Category: Antibodies
• Description: Rabbit polyclonal antibody to UBE2N
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: IHC, WB
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Rabbit, Rat, Sheep, Yeast, Zebrafish
• Reactivity: Human, Mouse
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human UBE2N
• Concentration: 1.0 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 17kDa
• Target: UBE2N
• UniProt ID: P61088
• Protein Sequence: Synthetic peptide located within the following region: VDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPDDPLANDVAEQW
• NCBI: NP_003339
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: UBC13, UbcH13, HEL-S-71, UbcH-ben, UBCHBEN; UBC13
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Sample Tissue: Mouse Spleen, Antibody dilution: 1 ug/ml.

Lanes: 1: 40 ng HIS-UBE2D1 protein, 2: 40 ng HIS-UBE2D2 protein, 3: 40 ng HIS-UBE2D3 protein, 4: 40 ng HIS-UBE2D4 protein, 5: 40 ng HIS-UBE2E1 protein, 6: 40 ng HIS-UBE2E2 protein, 7: 40 ng HIS-UBE2E3 protein, 8: 40 ng HIS-UBE2K protein, 9: 40 ng HIS-UBE2L3 protein, 10: 40 ng HIS-UBE2N protein, 11: 40 ng HIS-UBE2V1 protein, 12: 40 ng HIS-UBE2V2 protein. Primary Antibody dilution: 1:500, Secondary Antibody: Anti-rabbit-HRP, Secondary Antibody dilution: 1:50000, Gene Name: UBE2N.

Sample Type: Human brain stem cells, Primary Antibody dilution: 1:500, Secondary Antibody: Goat anti-rabbit Alexa-Fluor 594, Secondary Antibody dilution: 1:1000, Color/Signal Descriptions: UBE2N: Red DAPI:Blue, Gene Name: UBE2N.

WB Suggested Anti-UBE2N Antibody Titration: 1.25 ug/ml, Positive Control: HepG2 cell lysate, UBE2N is strongly supported by BioGPS gene expression data to be expressed in Human HepG2 cells.