You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb330276 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to UBE2L3 |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | IHC, WB |
Predicted Reactivity | Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat, Zebrafish |
Reactivity | Human |
Immunogen | The immunogen is a synthetic peptide directed towards the C terminal region of human UBE2L3 |
Concentration | 0.5 mg/ml |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Conjugation | Unconjugated |
MW | 17kDa |
Target | UBE2L3 |
UniProt ID | P68036 |
Protein Sequence | Synthetic peptide located within the following region: IQSLIALVNDPQPEHPLRADLAEEYSKDRKKFCKNAEEFTKKYGEKRPVD |
NCBI | NP_003338 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Alternative names | anti E2-F1 antibody, anti L-UBC antibody, anti UBC Read more... |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
Immunohistochemistry with Human Prostate lysate tissue at an antibody concentration of 5.0 ug/mL using anti-UBE2L3 antibody (orb330276).
WB Suggested Anti-UBE2L3 Antibody Titration: 0.2-1 ug/mL, Positive Control: Jurkat cell lysate, There is BioGPS gene expression data showing that UBE2L3 is expressed in Jurkat.
ICC, IHC-P, IP, WB | |
Human, Mouse, Zebrafish | |
Rabbit | |
Polyclonal | |
Unconjugated |
IF, IH, WB | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
ELISA, IHC, WB | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |