You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb578684 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to Ube2g1 |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | WB |
Predicted Reactivity | Bovine, Canine, Equine, Guinea pig, Human, Rabbit, Rat, Yeast, Zebrafish |
Reactivity | Mouse |
Concentration | 0.5 mg/ml |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Conjugation | Unconjugated |
MW | 19kDa |
Target | Ube2g1 |
UniProt ID | P62254 |
Protein Sequence | Synthetic peptide located within the following region: GPPDTLYEGGVFKAHLTFPKDYPLRPPKMKFITEIWHPNVDKNGDVCISI |
NCBI | NP_080261 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Alternative names | AI256795, AU014992, AW552068, 2700059C12Rik, D1300 Read more... |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
WB Suggested Anti-Ube2g1 Antibody, Titration: 1.0 ug/ml, Positive Control: Mouse Spleen.
IHC-P, WB | |
Rat | |
Human, Mouse | |
Rabbit | |
Polyclonal | |
Unconjugated |
IH, WB | |
Human, Mouse, Primate, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
IF, IHC-Fr, IHC-P | |
Canine, Equine, Mouse, Porcine, Rabbit, Sheep | |
Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |