UBE2E1 Rabbit Polyclonal Antibody

• Catalog Number: orb578847
• Category: Antibodies
• Description: Rabbit polyclonal antibody to UBE2E1
• Target: UBE2E1
• Clonality: Polyclonal
• Species/Host: Rabbit
• Conjugation: Unconjugated
• Reactivity: Human
• Predicted Reactivity: Canine, Mouse, Rabbit
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Protein Sequence: Synthetic peptide located within the following region: ETNTPKKKESKVSMSKNSKLLSTSAKSAGPKGDNIYEWRSTILGPPGSVY
• UniProt ID: P51965
• MW: 19kDa
• Tested applications: WB
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Alternative names: UBCH6
• Note: For research use only
• NCBI: NP_872607

WB Suggested Anti-UBE2E1 Antibody, Titration: 1.0 ug/ml, Positive Control: 721_B Whole Cell. UBE2E1 is supported by BioGPS gene expression data to be expressed in 721_B.