Cart summary

You have no items in your shopping cart.

Uap1l1 Rabbit Polyclonal Antibody (FITC)

Uap1l1 Rabbit Polyclonal Antibody (FITC)

Catalog Number: orb2113362

DispatchUsually dispatched within 5-10 working days
$ 680.00
Catalog Numberorb2113362
CategoryAntibodies
DescriptionUap1l1 Rabbit Polyclonal Antibody (FITC)
ClonalityPolyclonal
Species/HostRabbit
ConjugationFITC
Predicted ReactivityCanine, Equine, Guinea pig, Human, Mouse, Rat, Zebrafish
Form/AppearanceLiquid. Purified antibody supplied in 1x PBS buffer.
Buffer/PreservativesLiquid. Purified antibody supplied in 1x PBS buffer.
ImmunogenThe immunogen is a synthetic peptide corresponding to a region of Mouse
Protein SequenceSynthetic peptide located within the following region: KVPYVDEEGNLVKPLRPNGIKMEKFVFDVFQFAKNFVAFEVCREEEFSPL
UniProt IDQ3TW96
MW56kDa
Tested applicationsWB
StorageAll conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
Alternative names5730445F03Rik
NoteFor research use only
NCBINP_001028465