TXNL1 Rabbit Polyclonal Antibody

• Catalog Number: orb586128
• Category: Antibodies
• Description: Rabbit polyclonal antibody to TXNL1
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: WB
• Predicted Reactivity: Bovine, Canine, Equine, Goat, Guinea pig, Mouse, Rabbit, Rat
• Reactivity: Human
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 32kDa
• Target: TXNL1
• UniProt ID: O43396
• Protein Sequence: Synthetic peptide located within the following region: PRSMDFEEAERSEPTQALELTEDDIKEDGIVPLRYVKFQNVNSVTIFVQS
• NCBI: NP_004777
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: Txl, TXNL, TRP32, TXL-1, HEL-S-114
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Sample Tissue: Human ACHN Whole Cell, Antibody dilution: 1 ug/ml.

Sample Tissue: Human HT1080 Whole Cell, Antibody dilution: 1 ug/ml.

WB Suggested Anti-TXNL1 Antibody, Titration: 1.0 ug/ml, Positive Control: Fetal Lung.