TWNK Rabbit Polyclonal Antibody

SKU: orb324646

Description

Rabbit polyclonal antibody to C10orf2

Research Area

Epigenetics & Chromatin

Images & Validation

• Tested Applications: WB
• Reactivity: Human
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat, Zebrafish

Key Properties

• Host: Rabbit
• Clonality: Polyclonal
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human PEO1
• Target: TWNK
• Protein Sequence: Synthetic peptide located within the following region: GVFRKFATDNNCHVTLVIHPRKEDDDKELQTASIFGSAKASQEADNVLIL
• Molecular Weight: 77 kDa
• Purification: Affinity Purified
• Conjugation: Unconjugated

Storage & Handling

• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Expiration Date: 12 months from date of receipt.
• Disclaimer: For research use only

Alternative Names

anti C10orf2 antibody, anti FLJ21832 antibody, anti PEO antibody, anti PEOA3 antibody, anti SANDO antibody, anti TWINL antibody, anti PEO1 antibody, anti SCA8 antibody, anti ATXN8 antibody, anti IOSCA antibody, anti MTDPS7 antibody

25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 1 ug/mL of the antibody was used in this experiment. An isoform containing the peptide sequence is present at ~60 kDa.

Sample Tissue: Human 786-0 Whole Cell, Antibody Dilution: 1 ug/mL.

Sample Type: Hela, Lane A: Primary Antibody, Lane B: Primary Antibody + Blocking Peptide, Primary Antibody Concentration: 1 ug/mL, Peptide Concentration: 5.0 ug/mL, Lysate Quantity: 25 ug/lane/lane, Gel Concentration: 12%. C10orf2 is supported by BioGPS gene expression data to be expressed in Hela.

Positive control (+): HepG2 (HG), Negative control (-): Human stomach (ST), Antibody concentration: 1 ug/mL.

WB Suggested Anti-PEO1 Antibody Titration: 0.2-1 ug/mL, ELISA Titer: 1:312500, Positive Control: Jurkat cell lysate.

Quick Database Links

Gene Symbol

TWNK

UniProt

Q96RR1

RefSeq (Protein):NP_068602