TWNK Rabbit Polyclonal Antibody

SKU: orb324646

Description

TWNK Rabbit Polyclonal Antibody is an unconjugated, affinity purified antibody for the detection of TWNK. It is suitable for WB application. The immunogen is a synthetic peptide directed towards the middle region of human PEO1. This antibody reacts with Human samples and is predicted to react with Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat, Zebrafish. It is supplied as a liquid in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Research Area

Neuroscience

Images & Validation

• Tested Applications: WB
• Reactivity: Human
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat, Zebrafish

Key Properties

• Host: Rabbit
• Clonality: Polyclonal
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human PEO1
• Target: TWNK
• Protein Sequence: Synthetic peptide located within the following region: GVFRKFATDNNCHVTLVIHPRKEDDDKELQTASIFGSAKASQEADNVLIL
• Molecular Weight: 77 kDa
• Purification: Affinity Purified
• Conjugation: Unconjugated

Storage & Handling

• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Expiration Date: 12 months from date of receipt.
• Disclaimer: For research use only

Alternative Names

anti C10orf2 antibody, anti FLJ21832 antibody, anti PEO antibody, anti PEOA3 antibody, anti SANDO antibody, anti TWINL antibody, anti PEO1 antibody, anti SCA8 antibody, anti ATXN8 antibody, anti IOSCA antibody, anti MTDPS7 antibody

Quick Database Links

Gene Symbol

TWNK

UniProt

Q96RR1

RefSeq (Protein):NP_068602