TWIST1 Rabbit Polyclonal Antibody

• Catalog Number: orb329955
• Category: Antibodies
• Description: Rabbit polyclonal antibody to TWIST1
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: IHC, WB
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Mouse, Porcine, Rabbit, Rat, Zebrafish
• Reactivity: Human
• Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human TWIST1
• Concentration: 1.0 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 21kDa
• Target: TWIST1
• UniProt ID: Q15672
• Protein Sequence: Synthetic peptide located within the following region: DKLSKIQTLKLAARYIDFLYQVLQSDELDSKMASCSYVAHERLSYAFSVW
• NCBI: NP_000465
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: anti SCS antibody, anti ACS3 antibody, anti CRS1 a
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

References

Armando, Federico et al. Epithelial to Mesenchymal Transition (EMT) in a Laryngeal Squamous Cell Carcinoma of a Horse: Future Perspectives Animals (Basel), 10, E2318 (2020)

PubMed: 33297475

Sample Type: Jurkat, Lane A: Primary Antibody, Lane B: Primary Antibody + Blocking Peptide, Primary Antibody Concentration: 2.5 ug/mL, Peptide Concentration: 2.0 ug/mL, Lysate Quantity: 25 ug/lane, Gel Concentration: 12%.

Positive control (+): A549 (N03), Negative control (-): U937 (N31), Antibody concentration: 1 ug/mL.

Uterus

WB Suggested Anti-TWIST1 Antibody Titration: 2.5 ug/mL, ELISA Titer: 1:1562500, Positive Control: Jurkat cell lysate.