TUBB2A Rabbit Polyclonal Antibody

• Catalog Number: orb577466
• Category: Antibodies
• Description: Rabbit polyclonal antibody to TUBB2A
• Target: TUBB2A
• Clonality: Polyclonal
• Species/Host: Rabbit
• Conjugation: Unconjugated
• Reactivity: Human
• Predicted Reactivity: Mouse, Rat, Sheep
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Affinity Purified
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human TUBB2A
• Protein Sequence: Synthetic peptide located within the following region: AVNMVPFPRLHFFMPGFAPLTSRGSQQYRALTVPELTQQMFDSKNMMAAC
• UniProt ID: Q13885
• MW: 49kDa
• Tested applications: IHC, WB
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Alternative names: TUBB, TUBB2, CDCBM5
• Research Area: Epigenetics & Chromatin, Molecular Biology, Signal
• Note: For research use only
• NCBI: NP_001060
• Expiration Date: 12 months from date of receipt.

Antibody Dilution: 1.0 ug/ml, Sample Type: HepG2 cell lysate. TUBB2A is supported by BioGPS gene expression data to be expressed in HepG2.

Rabbit Anti-TUBB2A Antibody, Catalog Number: orb577466, Formalin Fixed Paraffin Embedded Tissue: Human Bone Marrow Tissue, Observed Staining: Cytoplasm, Primary Antibody Concentration: 1:100, Other Working Concentrations: 1:600, Secondary Antibody: Donkey anti-Rabbit-Cy3, Secondary Antibody Concentration: 1:200, Magnification: 20X, Exposure Time: 0.5-2.0 sec.

Small intestine, myenteric plexus.