You have no items in your shopping cart.
You have no items in your shopping cart.
| Catalog Number | orb577466 |
|---|---|
| Category | Antibodies |
| Description | Rabbit polyclonal antibody to TUBB2A |
| Target | TUBB2A |
| Clonality | Polyclonal |
| Species/Host | Rabbit |
| Conjugation | Unconjugated |
| Reactivity | Human |
| Predicted Reactivity | Mouse, Rat, Sheep |
| Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Concentration | 0.5 mg/ml |
| Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Purification | Affinity Purified |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human TUBB2A |
| Protein Sequence | Synthetic peptide located within the following region: AVNMVPFPRLHFFMPGFAPLTSRGSQQYRALTVPELTQQMFDSKNMMAAC |
| UniProt ID | Q13885 |
| MW | 49kDa |
| Tested applications | IHC, WB |
| Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
| Alternative names | TUBB, TUBB2, CDCBM5 |
| Research Area | Epigenetics & Chromatin, Molecular Biology, Signal Read more... |
| Note | For research use only |
| NCBI | NP_001060 |
| Expiration Date | 12 months from date of receipt. |

Antibody Dilution: 1.0 ug/ml, Sample Type: HepG2 cell lysate. TUBB2A is supported by BioGPS gene expression data to be expressed in HepG2.

Rabbit Anti-TUBB2A Antibody, Catalog Number: orb577466, Formalin Fixed Paraffin Embedded Tissue: Human Bone Marrow Tissue, Observed Staining: Cytoplasm, Primary Antibody Concentration: 1:100, Other Working Concentrations: 1:600, Secondary Antibody: Donkey anti-Rabbit-Cy3, Secondary Antibody Concentration: 1:200, Magnification: 20X, Exposure Time: 0.5-2.0 sec.

Small intestine, myenteric plexus.
FC, IF, IHC-Fr, IHC-P, WB | |
Rabbit | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
WB | |
Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Sheep, Zebrafish | |
Human, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
WB | |
Bovine, Canine, Equine, Guinea pig, Human, Rabbit, Rat, Zebrafish | |
Mouse | |
Rabbit | |
Polyclonal | |
Unconjugated |
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a Review