You have no items in your shopping cart.
TTLL3 Rabbit Polyclonal Antibody
SKU: orb326453
Description
Images & Validation
−Item 1 of 1
| Tested Applications | WB |
|---|---|
| Reactivity | Human |
| Predicted Reactivity | Human |
Key Properties
−| Host | Rabbit |
|---|---|
| Clonality | Polyclonal |
| Immunogen | The immunogen is a synthetic peptide directed towards the C-terminal region of TTLL3 |
| Target | TTLL3 |
| Protein Sequence | Synthetic peptide located within the following region: APVGRSRPKANSRPDCDKPRAEACPMKRLSPLKPLPLVGTFQRRRGLGDM |
| Molecular Weight | 48kDa |
| Purification | Affinity Purified |
| Conjugation | Unconjugated |
Storage & Handling
−| Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
|---|---|
| Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Concentration | 0.5 mg/ml |
| Expiration Date | 12 months from date of receipt. |
| Disclaimer | For research use only |
Alternative Names
−anti DKFZp434B103 antibody, anti DKFZp686D076 antibody, anti FLJ13898 antibody, anti HOTTL antibody, anti MGC120529 antibody, anti MGC120530 antibody, anti MGC120532 antibody
Similar Products
−- Item 1 of 1
ARPC4 Rabbit Polyclonal Antibody [orb324457]
WB
Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat, Yeast, Zebrafish
Human
Rabbit
Polyclonal
Unconjugated
100 μl - Item 1 of 1
- Item 1 of 1
Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].
WB Suggested Anti-TTLL3 Antibody, Titration: 1.0 ug/mL, Positive Control: Fetal Kidney.
Quick Database Links
UniProt Details
− No UniProt data available
NCBI Reference Sequences
−Associated Accession Numbers
Curated reference sequences for the gene transcript and protein product| Protein | NP_001021100 |
|---|
Documents Download
Datasheet
Product Information
Request a Document
TTLL3 Rabbit Polyclonal Antibody (orb326453)
- 0.0
Based on 0 reviews
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a ReviewAvailable Sizes
Select a size below
Usually dispatched within 1 - 2 weeks