Cart summary

You have no items in your shopping cart.

TTC26 Rabbit Polyclonal Antibody (HRP)

TTC26 Rabbit Polyclonal Antibody (HRP)

Catalog Number: orb2084795

Select Product Size
SizePriceQuantity
100 μl$ 0.00
100 μl Enquire
DispatchUsually dispatched within 5-10 working days
Product Properties
Catalog Numberorb2084795
CategoryAntibodies
DescriptionTTC26 Rabbit Polyclonal Antibody (HRP)
ClonalityPolyclonal
Species/HostRabbit
ConjugationHRP
Predicted ReactivityBovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat
Form/AppearanceLiquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Buffer/PreservativesLiquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
PurificationAffinity Purified
ImmunogenThe immunogen is a synthetic peptide directed towards the N-terminal region of Human TTC26
Protein SequenceSynthetic peptide located within the following region: LEFKRHVGEEEEDTNLWIGYCAFHLGDYKRALEEYENATKEENCNSEVWV
UniProt IDA0AVF1
MW56kDa
Tested applicationsWB
StorageAll conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
Alternative namesDYF13, IFT56, dyf-13
NoteFor research use only
NCBINP_079202
Images
Similar Products
  • TTC26 Rabbit Polyclonal Antibody (HRP) [orb2084792]

    WB

    Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rat

    Rabbit

    Polyclonal

    HRP

    100 μl
Reviews

TTC26 Rabbit Polyclonal Antibody (HRP) (orb2084795)

  • Star
  • Star
  • Star
  • Star
  • Star
  • 0.0
Based on 0 reviews

Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.

Login to Submit a Review

No reviews yet