Cart summary

You have no items in your shopping cart.

TTC12 Rabbit Polyclonal Antibody (Biotin)

TTC12 Rabbit Polyclonal Antibody (Biotin)

Catalog Number: orb2107276

DispatchUsually dispatched within 5-10 working days
$ 680.00
Catalog Numberorb2107276
CategoryAntibodies
DescriptionTTC12 Rabbit Polyclonal Antibody (Biotin)
Species/HostRabbit
ClonalityPolyclonal
Tested applicationsWB
Predicted ReactivityBovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat
ImmunogenThe immunogen is a synthetic peptide directed towards the C terminal region of human TTC12
Form/AppearanceLiquid. Purified antibody supplied in 1x PBS buffer.
ConjugationBiotin
MW81kDa
UniProt IDB0YJB4
Protein SequenceSynthetic peptide located within the following region: MNLCLQAPFVSEVWAVEVSRRCLSLLNSQDGGILTRAAGVLSRTLSSSLK
NCBINP_060338
StorageAll conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
Buffer/PreservativesLiquid. Purified antibody supplied in 1x PBS buffer.
Alternative namesTPARM, CILD45
Read more...
NoteFor research use only
Expiration Date12 months from date of receipt.