TSTA3 Rabbit Polyclonal Antibody

• Catalog Number: orb584081
• Category: Antibodies
• Description: Rabbit polyclonal antibody to TSTA3
• Target: TSTA3
• Clonality: Polyclonal
• Species/Host: Rabbit
• Conjugation: Unconjugated
• Reactivity: Human
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Affinity Purified
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human TSTA3
• Protein Sequence: Synthetic peptide located within the following region: MGEPQGSMRILVTGGSGLVGKAIQKVVADGAGLPGEDWVFVSSKDADLTD
• UniProt ID: Q13630
• MW: 36 kDa
• Tested applications: IHC, WB
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Alternative names: FX, P35B, TSTA3, SDR4E1
• Research Area: Cell Biology, Molecular Biology, Stem Cell & Devel
• Note: For research use only
• NCBI: NP_003304

25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 3 ug/ml of the antibody was used in this experiment.

Sample Tissue: Human ACHN Whole Cell, Antibody dilution: 3 ug/ml.

Sample Type: 721_B, Antibody dilution: 1.0 ug/ml. TSTA3 is strongly supported by BioGPS gene expression data to be expressed in Human 721_B cells.

Sample Type: Hela, Antibody dilution: 1.0 ug/ml. TSTA3 is strongly supported by BioGPS gene expression data to be expressed in HeLa.

Rabbit Anti-TSTA3 Antibody, Catalog Number: orb584081, Formalin Fixed Paraffin Embedded Tissue: Human Adult Liver, Observed Staining: Cytoplasm in hepatocytes, strong signal, low tissue distribution, Primary Antibody Concentration: 1:100, Secondary Antibody: Donkey anti-Rabbit-Cy3, Secondary Antibody Concentration: 1:200, Magnification: 20X, Exposure Time: 0.5-2.0 sec, Protocol located in Reviews and Data.

WB Suggested Anti-TSTA3 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:312500, Positive Control: MCF7 cell lysate. TSTA3 is supported by BioGPS gene expression data to be expressed in MCF7.