TSPAN8 Rabbit Polyclonal Antibody

SKU: orb579802

Description

Rabbit polyclonal antibody to TSPAN8

Research Area

Cell Biology, Protein Biochemistry, Signal Transduction, Stem Cell & Developmental Biology

Images & Validation

• Tested Applications: WB
• Reactivity: Human
• Predicted Reactivity: Guinea pig, Mouse

Key Properties

• Host: Rabbit
• Clonality: Polyclonal
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human TSPAN8
• Target: TSPAN8
• Protein Sequence: Synthetic peptide located within the following region: VFKSKSDRIVNETLYENTKLLSATGESEKQFQEAIIVFQEEFKCCGLVNG
• Molecular Weight: 26kDa
• Purification: Affinity Purified
• Conjugation: Unconjugated

Storage & Handling

• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Expiration Date: 12 months from date of receipt.
• Disclaimer: For research use only

Alternative Names

CO-029, TM4SF3

WB Suggested Anti-TSPAN8 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:62500, Positive Control: Human brain.

Quick Database Links

Gene Symbol

TSPAN8

UniProt

P19075

RefSeq (Protein):NP_004607