TSKS Rabbit Polyclonal Antibody

• Catalog Number: orb582206
• Category: Antibodies
• Description: Rabbit polyclonal antibody to TSKS
• Target: TSKS
• Clonality: Polyclonal
• Species/Host: Rabbit
• Conjugation: Unconjugated
• Reactivity: Human
• Predicted Reactivity: Bovine, Canine, Mouse, Porcine, Rabbit, Rat
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Affinity Purified
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human TSKS
• Protein Sequence: Synthetic peptide located within the following region: MASVVVKTIWQSKEIHEAGDTPTGVESCSQLVPEAPRRVTSRAKGIPKKK
• UniProt ID: Q9UJT2
• MW: 65kDa
• Tested applications: IHC, WB
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Alternative names: TSKS1, TSSKS, STK22S1, PPP1R161
• Research Area: Cell Biology, Immunology & Inflammation, Signal Tr
• Note: For research use only
• NCBI: NP_068379
• Expiration Date: 12 months from date of receipt.

Human Testis

Immunohistochemistry with Human Testis lysate tissue at an antibody concentration of 5.0 ug/ml using anti-TSKS antibody (orb582206).

WB Suggested Anti-TSKS Antibody Titration: 1 ug/ml, Positive Control: HepG2 cell lysate.