Trpv6 Rabbit Polyclonal Antibody

• Catalog Number: orb575431
• Category: Antibodies
• Description: Rabbit polyclonal antibody to Trpv6
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: IHC, WB
• Predicted Reactivity: Canine, Equine, Guinea pig, Mouse, Rabbit
• Reactivity: Human, Rat
• Immunogen: The immunogen is a synthetic peptide corresponding to a region of Rat
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 83kDa
• Target: Trpv6
• UniProt ID: Q9R186
• Protein Sequence: Synthetic peptide located within the following region: TEIDSSGDDQSLLELIVTTKKREARQILDQTPVKELVSLKWKRYGRPYFC
• NCBI: NP_446138
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: CaT1, Ecac2, Otrpc3
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Sample Type: hRetinal pigment epithelial cells, 4 individual donors (20 ug), Primary dilution: 1:1000, Secondary Antibody: goat anti-rabbit-AP, Secondary dilution: 1:2000.

Sample Type: hRetinal pigment epithelial cells, Green: primary, Red: nuclear, Primary dilution: 1:200, Secondary Antibody: goat anti-rabbit-Alexa 488, Secondary dilution: 1:500.

Sample Tissue: Human Hela Whole Cell, Antibody dilution: 1 ug/ml.

Sample Tissue: Human Hela Whole Cell, Antibody dilution: 2 ug/ml.

Trpv6 antibody - middle region (orb575431) validated by WB using Rat Brain lysate at 1 ug/ml.