You have no items in your shopping cart.
Trpv6 Rabbit Polyclonal Antibody
Description
Research Area
Images & Validation
−| Tested Applications | IHC, WB |
|---|---|
| Reactivity | Human, Rat |
| Predicted Reactivity | Canine, Equine, Guinea pig, Mouse, Rabbit |
Key Properties
−| Host | Rabbit |
|---|---|
| Clonality | Polyclonal |
| Immunogen | The immunogen is a synthetic peptide corresponding to a region of Rat |
| Target | Trpv6 |
| Protein Sequence | Synthetic peptide located within the following region: TEIDSSGDDQSLLELIVTTKKREARQILDQTPVKELVSLKWKRYGRPYFC |
| Molecular Weight | 83kDa |
| Purification | Affinity Purified |
| Conjugation | Unconjugated |
Storage & Handling
−| Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
|---|---|
| Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Concentration | 0.5 mg/ml |
| Expiration Date | 12 months from date of receipt. |
| Disclaimer | For research use only |
Alternative Names
−Similar Products
−TRPV6 Rabbit Polyclonal Antibody [orb158655]
FC
Human, Rat
Mouse
Rabbit
Polyclonal
Unconjugated
50 μl, 100 μl, 200 μlTRPV6 Antibody [orb632191]
ELISA, IF, IP, WB
Human, Mouse, Rat
Rabbit
Polyclonal
Unconjugated
50 μg, 100 μgTRPV6 rabbit pAb Antibody [orb773266]
ELISA, WB
Human, Mouse, Rat
Polyclonal
Unconjugated
50 μl, 100 μl

Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

Sample Type: hRetinal pigment epithelial cells, 4 individual donors (20 ug), Primary dilution: 1:1000, Secondary Antibody: goat anti-rabbit-AP, Secondary dilution: 1:2000.

Sample Type: hRetinal pigment epithelial cells, Green: primary, Red: nuclear, Primary dilution: 1:200, Secondary Antibody: goat anti-rabbit-Alexa 488, Secondary dilution: 1:500.

Sample Tissue: Human Hela Whole Cell, Antibody dilution: 1 ug/ml.

Sample Tissue: Human Hela Whole Cell, Antibody dilution: 2 ug/ml.

Trpv6 antibody - middle region (orb575431) validated by WB using Rat Brain lysate at 1 ug/ml.
Documents Download
Request a Document
Protocol Information
Trpv6 Rabbit Polyclonal Antibody (orb575431)
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a Review




