You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb575445 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to TRPV4 |
Target | TRPV4 |
Clonality | Polyclonal |
Species/Host | Rabbit |
Conjugation | Unconjugated |
Reactivity | Human, Rat |
Predicted Reactivity | Bovine, Canine, Guinea pig, Mouse, Porcine, Rabbit |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Concentration | 0.5 mg/ml |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human TRPV4 |
Protein Sequence | Synthetic peptide located within the following region: RVDEVNWSHWNQNLGIINEDPGKNETYQYYGFSHTVGRLRRDRWSSVVPR |
UniProt ID | Q9HBA0 |
MW | 91kDa |
Tested applications | IHC, WB |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Alternative names | SMAL, VRL2, BCYM3, CMT2C, SPSMA, TRP12, VROAC, HMS Read more... |
Note | For research use only |
NCBI | NP_671737 |
TRPV4 Rat Hippocampus We tested the antibodies in Immunohistochemistry studies. The dilutions for all the above primary antibodies were 1:500 and the same for the secondary antibody, Alexa Fluor 568-conjugated goat anti-rabbit antibodies (Invitrogen).
WB Suggested Anti-TRPV4 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:12500, Positive Control: ACHN cell lysate.
IHC, WB | |
Bovine, Canine, Guinea pig, Mouse, Porcine, Rabbit | |
Human, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
FC, ICC, IF, IHC-Fr, IHC-P | |
Bovine, Canine, Gallus, Porcine, Rat | |
Human, Mouse | |
Rabbit | |
Polyclonal | |
Unconjugated |
IHC, WB | |
Bovine, Canine, Mouse, Porcine, Rat | |
Human | |
Rabbit | |
Polyclonal | |
Unconjugated |
IF, WB | |
Human, Mouse, Porcine, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
WB | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |