You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb575481 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to TRPV4 |
Target | TRPV4 |
Clonality | Polyclonal |
Species/Host | Rabbit |
Conjugation | Unconjugated |
Reactivity | Human, Rat |
Predicted Reactivity | Bovine, Canine, Guinea pig, Mouse, Porcine, Rabbit |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Concentration | 0.5 mg/ml |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human TRPV4 |
Protein Sequence | Synthetic peptide located within the following region: RVDEVNWSHWNQNLGIINEDPGKNETYQYYGFSHTVGRLRRDRWSSVVPR |
UniProt ID | Q9HBA0 |
MW | 98 kDa |
Tested applications | IHC, WB |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Alternative names | SMAL, VRL2, BCYM3, CMT2C, SPSMA, TRP12, VROAC, HMS Read more... |
Note | For research use only |
NCBI | NP_671737 |
25 ug of the indicated Human whole cell extracts was loaded onto a 6-18% SDS-PAGE gel. 0.3 ug/ml of the antibody was used in this experiment. Isoform 2 is identified as 91 kDa, the canonical 98 kDa from can be observed in some samples, and several isoforms of this protein contain the immunizing peptide including a 60 kDa form.
Sample Tissue: Human THP-1 Whole Cell, Antibody dilution: 1 ug/ml.
Sample Type: HT1080, Antibody dilution: 1.0 ug/ml.
Sample Type: PANC1, Antibody dilution: 1.0 ug/ml. TRPV4 is supported by BioGPS gene expression data to be expressed in PANC1.
Rat Hippocamus
WB Suggested Anti-TRPV4 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:312500, Positive Control: HT1080 cell lysate.
FC, ICC, IF, IHC-Fr, IHC-P | |
Bovine, Canine, Gallus, Porcine, Rat | |
Human, Mouse | |
Rabbit | |
Polyclonal | |
Unconjugated |
IHC, WB | |
Bovine, Canine, Mouse, Porcine, Rat | |
Human | |
Rabbit | |
Polyclonal | |
Unconjugated |
IF, WB | |
Human, Mouse, Porcine, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
IHC, WB | |
Bovine, Canine, Guinea pig, Mouse, Porcine, Rabbit | |
Human, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
WB | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |