You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb575414 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to TRPM5 |
Target | TRPM5 |
Clonality | Polyclonal |
Species/Host | Rabbit |
Conjugation | Unconjugated |
Reactivity | Human |
Predicted Reactivity | Bovine, Canine, Equine, Guinea pig, Mouse, Rat |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Concentration | 0.5 mg/ml |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human TRPM5 |
Protein Sequence | Synthetic peptide located within the following region: EKHISEQRAGYGGTGSIEIPVLCLLVNGDPNTLERISRAVEQAAPWLILV |
UniProt ID | Q9NZQ8 |
MW | 131kDa |
Tested applications | IHC, WB |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Alternative names | MTR1, LTRPC5 |
Note | For research use only |
NCBI | NP_055370 |
Immunohistochemistry with Pancreas tissue at an antibody concentration of 5 ug/ml using anti-TRPM5 antibody (orb575414).
WB Suggested Anti-TRPM5 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:62500, Positive Control: HepG2 cell lysate.
IHC, WB | |
Bovine, Canine, Equine, Guinea pig, Mouse, Rat | |
Human | |
Rabbit | |
Polyclonal | |
Unconjugated |
WB | |
Bovine, Canine, Equine, Gallus, Human, Rat | |
Mouse | |
Rabbit | |
Polyclonal | |
Unconjugated |
WB | |
Bovine, Rat | |
Human, Mouse | |
Rabbit | |
Polyclonal | |
Unconjugated |