TRPM4 Rabbit Polyclonal Antibody

• Catalog Number: orb575427
• Category: Antibodies
• Description: Rabbit polyclonal antibody to TRPM4
• Target: TRPM4
• Clonality: Polyclonal
• Species/Host: Rabbit
• Conjugation: Unconjugated
• Reactivity: Human, Rat
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Mouse
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human TRPM4
• Protein Sequence: Synthetic peptide located within the following region: ELLTVYSSEDGSEEFETIVLKALVKACGSSEASAYLDELRLAVAWNRVDI
• UniProt ID: Q8TD43
• MW: 134 kDa
• Tested applications: WB
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Alternative names: EKVP6, LTrpC4, PFHB1B, TRPM4B, hTRPM4
• Note: For research use only
• NCBI: NP_060106

25 ug of the indicated Human whole cell extracts was loaded onto a 6-18% SDS-PAGE gel. 2 ug/ml of the antibody was used in this experiment.

Sample Type: 293T, Antibody dilution: 1.0 ug/ml.

Sample Type: 721_B, Antibody dilution: 1.0 ug/ml.

Sample Type: Hela, Antibody dilution: 1.0 ug/ml.

Sample Type: HepG2, Antibody dilution: 1.0 ug/ml.

Sample Type: Jurkat, Antibody dilution: 1.0 ug/ml.

Sample Type: MCF7, Antibody dilution: 1.0 ug/ml.

Sample Tissue: Rat Brain, Antibody dilution: 1 ug/ml.

WB Suggested Anti-TRPM4 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:312500, Positive Control: 293T cell lysate.