Cart summary

You have no items in your shopping cart.

TRO Rabbit Polyclonal Antibody (Biotin)

TRO Rabbit Polyclonal Antibody (Biotin)

Catalog Number: orb2093752

DispatchUsually dispatched within 5-10 working days
$ 680.00
Catalog Numberorb2093752
CategoryAntibodies
DescriptionTRO Rabbit Polyclonal Antibody (Biotin)
Species/HostRabbit
ClonalityPolyclonal
Tested applicationsWB
Predicted ReactivityHuman
ImmunogenThe immunogen is a synthetic peptide directed towards the C-terminal region of Human TRO
Form/AppearanceLiquid. Purified antibody supplied in 1x PBS buffer.
ConjugationBiotin
MW33kDa
UniProt IDB1AKF1
Protein SequenceSynthetic peptide located within the following region: EAEARAEIYSPCLQIPLINCSSPSHGAKVHPWNLCPHSSQGSYGQSAEGV
NCBINP_808225
StorageAll conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
Buffer/PreservativesLiquid. Purified antibody supplied in 1x PBS buffer.
Alternative namesMAGED3, MAGE-d3
Read more...
NoteFor research use only
Expiration Date12 months from date of receipt.