C14orf172 Rabbit Polyclonal Antibody

• Catalog Number: orb325435
• Category: Antibodies
• Description: Rabbit polyclonal antibody to TRMT61A
• Target: TRMT61A
• Clonality: Polyclonal
• Species/Host: Rabbit
• Conjugation: Unconjugated
• Reactivity: Human
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat, Zebrafish
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Affinity Purified
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human C14orf172
• Protein Sequence: Synthetic peptide located within the following region: MSFVAYEELIKEGDTAILSLGHGAMVAVRVQRGAQTQTRHGVLRHSVDLI
• UniProt ID: Q96FX7
• MW: 31kDa
• Tested applications: WB
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Alternative names: anti FLJ40452 antibody, anti GCD14 antibody, anti
• Research Area: Epigenetics & Chromatin, Molecular Biology
• Note: For research use only
• NCBI: NP_689520
• Expiration Date: 12 months from date of receipt.

WB Suggested Anti-C14orf172 Antibody Titration: 0.2-1 ug/mL, ELISA Titer: 1:1562500, Positive Control: SH-SYSY cell lysate.