Cart summary

You have no items in your shopping cart.

    TRIO antibody

    TRIO antibody

    Catalog Number: orb581124

    DispatchUsually dispatched within 3-7 working days
    $ 609.00
    Catalog Numberorb581124
    CategoryAntibodies
    DescriptionRabbit polyclonal antibody to TRIO
    Species/HostRabbit
    ClonalityPolyclonal
    Tested applicationsWB
    Predicted ReactivityAnimal, Bovine, Canine, Guinea pig, Human, Mouse, Rabbit, Rat
    ReactivityAnimal, Bovine, Canine, Guinea pig, Human, Mouse, Rat
    ImmunogenThe immunogen is a synthetic peptide directed towards the C-terminal region of Human TRIO
    Concentration0.5 mg/ml
    Form/AppearanceLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
    ConjugationUnconjugated
    MW65kDa
    TargetTRIO
    UniProt IDO75962
    Protein SequenceSynthetic peptide located within the following region: PGFVLGHTSAVIVENPDGTLKKSTSWHTALRLRKKSEKKDKDGKREGKLE
    StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -2°C in small aliquots to prevent freeze-thaw cycles.
    Buffer/PreservativesLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
    Alternative namestgat, MEBAS, MRD44, MRD63, ARHGEF23
    Read more...
    NoteFor research use only
    Expiration Date12 months from date of receipt.
    • TRIOBP antibody [orb412289]

      IH,  WB

      Human, Mouse

      Rabbit

      Polyclonal

      Unconjugated

      200 μl, 100 μl, 50 μl
    • TRIO Antibody [orb1523307]

      IP,  WB

      Human

      Rabbit

      Polyclonal

      Unconjugated

      10 μg
    • TRIO Antibody [orb1523308]

      IP,  WB

      Human

      Rabbit

      Polyclonal

      Unconjugated

      100 μg
    • TRIOBP antibody [orb681958]

      ELISA,  IF,  WB

      Human, Mouse, Rat

      Rabbit

      Polyclonal

      Unconjugated

      100 μl
    • SPAC589.09 antibody [orb857182]

      ELISA,  WB

      Bacteria

      Rabbit

      Polyclonal

      Unconjugated

      10 mg
    Submit a review

    Filter by Rating

      • Star
      • Star
      • Star
      • Star
      • Star
      • 5 stars
      • Star
      • Star
      • Star
      • Star
      • Star
      • 4 stars
      • Star
      • Star
      • Star
      • Star
      • Star
      • 3 stars
      • Star
      • Star
      • Star
      • Star
      • Star
      • 2 stars
      • Star
      • Star
      • Star
      • Star
      • Star
      • 1 stars