You have no items in your shopping cart.
Description
Research Area
Images & Validation
−| Tested Applications | IHC, WB |
|---|---|
| Reactivity | Human |
| Predicted Reactivity | Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat, Yeast |
Key Properties
−| Host | Rabbit |
|---|---|
| Clonality | Polyclonal |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human TRIB1 |
| Target | TRIB1 |
| Protein Sequence | Synthetic peptide located within the following region: TEERTQLRLESLEDTHIMKGEDDALSDKHGCPAYVSPEILNTTGTYSGKA |
| Molecular Weight | 41 kDa |
| Purification | Affinity Purified |
| Conjugation | Unconjugated |
Storage & Handling
−| Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
|---|---|
| Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Concentration | 0.5 mg/ml |
| Expiration Date | 12 months from date of receipt. |
| Disclaimer | For research use only |
Alternative Names
−Similar Products
−TRIB1 Rabbit Polyclonal Antibody [orb330688]
WB
Bovine, Equine, Guinea pig, Mouse, Porcine, Rat
Human
Rabbit
Polyclonal
Unconjugated
100 μlTRIB1 Rabbit Polyclonal Antibody [orb411675]
WB
Human
Rabbit
Polyclonal
Unconjugated
100 μl, 50 μl, 200 μl, 30 μlTRIB1 Rabbit Polyclonal Antibody (HRP) [orb2109323]
IHC, WB
Bovine, Equine, Guinea pig, Human, Mouse, Porcine, Rat
Rabbit
Polyclonal
HRP
100 μl

Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 1 ug/ml of the antibody was used in this experiment.

Sample Tissue: Human Stomach Tumor, Antibody dilution: 1.0 ug/ml.

Sample Type: COLO205, Antibody dilution: 1.0 ug/ml. TRIB1 is supported by BioGPS gene expression data to be expressed in COLO205.

Positive control (+): Human intestine (IN), Negative control (-): THP-1 (N30), Antibody concentration: 1 ug/ml.

Rabbit Anti-TRIB1 Antibody, Catalog Number: orb330687, Formalin Fixed Paraffin Embedded Tissue: Human Lung Tissue, Observed Staining: Cytoplasmic in alveolar type I & II cells, Primary Antibody Concentration: 1:100, Secondary Antibody: Donkey anti-Rabbit-Cy3, Secondary Antibody Concentration: 1:200, Magnification: 20X, Exposure Time: 0.5-2.0 sec.

WB Suggested Anti-TRIB1 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:312500, Positive Control: Human Intestine.
Documents Download
Request a Document
Protocol Information
TRIB1 Rabbit Polyclonal Antibody (orb330687)
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a Review





