TRIB1 Rabbit Polyclonal Antibody

• Catalog Number: orb330687
• Category: Antibodies
• Description: Rabbit polyclonal antibody to TRIB1
• Target: TRIB1
• Clonality: Polyclonal
• Species/Host: Rabbit
• Conjugation: Unconjugated
• Reactivity: Human
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat, Yeast
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Affinity Purified
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human TRIB1
• Protein Sequence: Synthetic peptide located within the following region: TEERTQLRLESLEDTHIMKGEDDALSDKHGCPAYVSPEILNTTGTYSGKA
• UniProt ID: Q96RU8
• MW: 41 kDa
• Tested applications: IHC, WB
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Alternative names: anti C8FW antibody, anti GIG2 antibody, anti SKIP1
• Research Area: Epigenetics & Chromatin
• Note: For research use only
• NCBI: NP_079471

25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 1 ug/ml of the antibody was used in this experiment.

Sample Tissue: Human Stomach Tumor, Antibody dilution: 1.0 ug/ml.

Sample Type: COLO205, Antibody dilution: 1.0 ug/ml. TRIB1 is supported by BioGPS gene expression data to be expressed in COLO205.

Positive control (+): Human intestine (IN), Negative control (-): THP-1 (N30), Antibody concentration: 1 ug/ml.

Rabbit Anti-TRIB1 Antibody, Catalog Number: orb330687, Formalin Fixed Paraffin Embedded Tissue: Human Lung Tissue, Observed Staining: Cytoplasmic in alveolar type I & II cells, Primary Antibody Concentration: 1:100, Secondary Antibody: Donkey anti-Rabbit-Cy3, Secondary Antibody Concentration: 1:200, Magnification: 20X, Exposure Time: 0.5-2.0 sec.

WB Suggested Anti-TRIB1 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:312500, Positive Control: Human Intestine.