TRAP1 Rabbit Polyclonal Antibody (FITC)

• Catalog Number: orb2081559
• Category: Antibodies
• Description: TRAP1 Rabbit Polyclonal Antibody (FITC)
• Clonality: Polyclonal
• Species/Host: Rabbit
• Conjugation: FITC
• Predicted Reactivity: Canine, Guinea pig, Human, Mouse, Rat
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer.
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human TRAP1
• Protein Sequence: Synthetic peptide located within the following region: AQLGPRRNPAWSLQAGRLFSTQTAEDKEEPLHSIISSTESVQGSTSKHEF
• UniProt ID: Q12931
• MW: 80kDa
• Tested applications: IHC, WB
• Storage: All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
• Alternative names: HSP75, HSP 75, HSP90L, TRAP-1
• Note: For research use only
• NCBI: NP_057376