You have no items in your shopping cart.
Cart summary
Item 1 of 2
Item 1 of 2
TRAP1 Rabbit Polyclonal Antibody
Catalog Number: orb592641
| Catalog Number | orb592641 |
|---|---|
| Category | Antibodies |
| Description | Rabbit polyclonal antibody to TRAP1 |
| Species/Host | Rabbit |
| Clonality | Polyclonal |
| Tested applications | IHC, WB |
| Predicted Reactivity | Canine, Guinea pig, Mouse, Rat |
| Reactivity | Human |
| Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human TRAP1 |
| Concentration | 1.0 mg/ml |
| Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Conjugation | Unconjugated |
| MW | 80kDa |
| Target | TRAP1 |
| UniProt ID | Q12931 |
| Protein Sequence | Synthetic peptide located within the following region: AQLGPRRNPAWSLQAGRLFSTQTAEDKEEPLHSIISSTESVQGSTSKHEF |
| NCBI | NP_057376 |
| Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
| Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Alternative names | HSP75, HSP 75, HSP90L, TRAP-1 Read more... |
| Note | For research use only |
| Expiration Date | 12 months from date of receipt. |
Human kidney
WB Suggested Anti-TRAP1 Antibody Titration: 0.5 ug/ml, ELISA Titer: 1:312500, Positive Control: HepG2 cell lysate. TRAP1 is supported by BioGPS gene expression data to be expressed in HepG2.
- Item 1 of 3
Anti-HSP75 Antibody [orb382090]
IF, IH, WB
Human, Mouse, Rat
Rabbit
Polyclonal
Unconjugated
200 μl, 100 μl, 50 μl - Item 1 of 2
- Item 1 of 2
- Item 1 of 1
- Item 1 of 1
Anti-VPS39 Antibody [orb668623]
IF, WB
Human, Mouse, Rat
Rabbit
Polyclonal
Unconjugated
200 μl, 100 μl, 50 μl
