You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb578799 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to TRAF7 |
Target | TRAF7 |
Clonality | Polyclonal |
Species/Host | Rabbit |
Conjugation | Unconjugated |
Reactivity | Human |
Predicted Reactivity | Bovine, Canine, Equine, Guinea pig, Mouse, Porcine, Rat |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Concentration | 0.5 mg/ml |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human TRAF7 |
Protein Sequence | Synthetic peptide located within the following region: GPAFSAVTTITKADGTSTYKQHCRTPSSSSTLAYSPRDEEDSMPPISTPR |
UniProt ID | Q6Q0C0 |
MW | 75 kDa |
Tested applications | WB |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Alternative names | RFWD1, RNF119, CAFDADD |
Note | For research use only |
NCBI | NP_115647 |
25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 3 ug/ml of the antibody was used in this experiment.
Sample Tissue: Human U937 Whole Cell, Antibody Dilution: 1 ug/ml.
Positive control (+): MCF7 Cell Lysate (N10), Negative control (-): Human Stomach Tumor (T-ST), Antibody concentration: 5 ug/ml.
WB Suggested Anti-TRAF7 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:1562500, Positive Control: Human Stomach.
ELISA, IHC, IP, WB | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
WB | |
Human, Mouse | |
Rabbit | |
Polyclonal | |
Unconjugated |
WB | |
Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rat | |
Rabbit | |
Polyclonal | |
HRP |
WB | |
Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rat | |
Rabbit | |
Polyclonal | |
FITC |