TRAF7 Rabbit Polyclonal Antibody

• Catalog Number: orb578799
• Category: Antibodies
• Description: Rabbit polyclonal antibody to TRAF7
• Target: TRAF7
• Clonality: Polyclonal
• Species/Host: Rabbit
• Conjugation: Unconjugated
• Reactivity: Human
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Mouse, Porcine, Rat
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human TRAF7
• Protein Sequence: Synthetic peptide located within the following region: GPAFSAVTTITKADGTSTYKQHCRTPSSSSTLAYSPRDEEDSMPPISTPR
• UniProt ID: Q6Q0C0
• MW: 75 kDa
• Tested applications: WB
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Alternative names: RFWD1, RNF119, CAFDADD
• Note: For research use only
• NCBI: NP_115647

25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 3 ug/ml of the antibody was used in this experiment.

Sample Tissue: Human U937 Whole Cell, Antibody Dilution: 1 ug/ml.

Positive control (+): MCF7 Cell Lysate (N10), Negative control (-): Human Stomach Tumor (T-ST), Antibody concentration: 5 ug/ml.

WB Suggested Anti-TRAF7 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:1562500, Positive Control: Human Stomach.