You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb330806 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to Traf3ip1 |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | WB |
Predicted Reactivity | Animal, Bovine, Canine, Guinea pig, Human, Mouse, Rat, Zebrafish |
Reactivity | Canine, Equine, Guinea pig, Human, Mouse, Rat, Zebrafish |
Immunogen | The immunogen is a synthetic peptide directed towards the N-terminal region of Mouse Traf3ip1 |
Concentration | 0.5 mg/ml |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Conjugation | Unconjugated |
MW | 69kDa |
Target | Traf3ip1 |
UniProt ID | Q149C2 |
Protein Sequence | Synthetic peptide located within the following region: VIRITGFMKGLYTDAEMKSENVKDKDAKISFLQKAIDVVMMVSGEPLAAK |
NCBI | NP_082994 |
Storage | For short term use, store at 2-8C up to 1 week. For long term storage, store at -2°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Alternative names | anti 3930402D05Rik antibody, anti AU041749 antibod Read more... |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
Western blot analysis of mouse Testis tissue using Traf3ip1 antibody
ELISA, IHC, WB | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
ELISA, IHC, WB | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
Filter by Rating