TRA2B antibody

• Catalog Number: orb324872
• Category: Antibodies
• Description: Rabbit polyclonal antibody to TRA2B
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: IHC, WB
• Predicted Reactivity: Animal, Bovine, Canine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish
• Reactivity: Canine, Equine, Guinea pig, Human, Mouse, Rat, Zebrafish
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human SFRS10
• Concentration: 1.0 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 32kDa
• Target: TRA2B
• UniProt ID: P62995
• Protein Sequence: Synthetic peptide located within the following region: GVFGLSLYTTERDLREVFSKYGPIADVSIVYDQQSRRSRGFAFVYFENVD
• NCBI: NP_004584
• Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -2°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: anti SFRS10 antibody, anti SRFS10 antibody, anti T
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Immunohistochemical staining of human Lung tissue using TRA2B antibody

Western blot analysis of 293T cell lysate tissue using TRA2B antibody

Immunohistochemical staining of human Muscle tissue using TRA2B antibody