SFRS10 Rabbit Polyclonal Antibody

SKU: orb324872

Description

SFRS10 Rabbit Polyclonal Antibody is an unconjugated, Protein A purified antibody for the detection of TRA2B. It is suitable for IHC, WB applications. The immunogen is a synthetic peptide directed towards the middle region of human SFRS10. This antibody reacts with Human samples and is predicted to react with Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat, Zebrafish. It is supplied as a liquid in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Research Area

Molecular Biology

Images & Validation

• Tested Applications: IHC, WB
• Reactivity: Human
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat, Zebrafish

Key Properties

• Host: Rabbit
• Clonality: Polyclonal
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human SFRS10
• Target: TRA2B
• Protein Sequence: Synthetic peptide located within the following region: GVFGLSLYTTERDLREVFSKYGPIADVSIVYDQQSRRSRGFAFVYFENVD
• Molecular Weight: 32kDa
• Purification: Protein A purified
• Conjugation: Unconjugated

Storage & Handling

• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 1.0 mg/ml
• Expiration Date: 12 months from date of receipt.
• Disclaimer: For research use only

Alternative Names

anti SFRS10 antibody, anti SRFS10 antibody, anti TRAN2B antibody, anti TRA2-BETA antibody, anti Htra2-beta antibody

Quick Database Links

Gene Symbol

TRA2B

UniProt

P62995

RefSeq (Protein):NP_004584