TPD52 Rabbit Polyclonal Antibody

• Catalog Number: orb330545
• Category: Antibodies
• Description: Rabbit polyclonal antibody to TPD52
• Target: TPD52
• Clonality: Polyclonal
• Species/Host: Rabbit
• Conjugation: Unconjugated
• Reactivity: Human, Mouse
• Predicted Reactivity: Bovine, Equine, Guinea pig, Rabbit, Rat, Zebrafish
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human TPD52
• Protein Sequence: Synthetic peptide located within the following region: AGQKASAAFSSVGSVITKKLEDVKNSPTFKSFEEKVENLKSKVGGTKPAG
• UniProt ID: P55327
• MW: 24kDa
• Tested applications: IHC, WB
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Alternative names: anti D52 antibody, anti N8L antibody, anti PC-1 an
• Note: For research use only
• NCBI: NP_001020423

Application: Immunofluorescence, Species+tissue/cell type: Mouse retina, Primary antibody dilution: 1:200, Secondary antibody: Goat anti-rabbit Alexafluor 568, Secondary antibody dilution: 1:200.

WB Suggested Anti-TPD52 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:312500, Positive Control: Jurkat cell lysate, TPD52 is strongly supported by BioGPS gene expression data to be expressed in Human Jurkat cells.