You have no items in your shopping cart.
You have no items in your shopping cart.
| Catalog Number | orb330545 |
|---|---|
| Category | Antibodies |
| Description | Rabbit polyclonal antibody to TPD52 |
| Target | TPD52 |
| Clonality | Polyclonal |
| Species/Host | Rabbit |
| Conjugation | Unconjugated |
| Reactivity | Human, Mouse |
| Predicted Reactivity | Bovine, Equine, Guinea pig, Rabbit, Rat, Zebrafish |
| Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Concentration | 0.5 mg/ml |
| Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Purification | Affinity Purified |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human TPD52 |
| Protein Sequence | Synthetic peptide located within the following region: AGQKASAAFSSVGSVITKKLEDVKNSPTFKSFEEKVENLKSKVGGTKPAG |
| UniProt ID | P55327 |
| MW | 24kDa |
| Tested applications | IHC, WB |
| Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
| Alternative names | anti D52 antibody, anti N8L antibody, anti PC-1 an Read more... |
| Research Area | Cell Biology, Stem Cell & Developmental Biology |
| Note | For research use only |
| NCBI | NP_001020423 |

Application: Immunofluorescence, Species+tissue/cell type: Mouse retina, Primary antibody dilution: 1:200, Secondary antibody: Goat anti-rabbit Alexafluor 568, Secondary antibody dilution: 1:200.

WB Suggested Anti-TPD52 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:312500, Positive Control: Jurkat cell lysate, TPD52 is strongly supported by BioGPS gene expression data to be expressed in Human Jurkat cells.
IHC, WB | |
Bovine, Canine, Equine, Guinea pig, Porcine, Rabbit, Rat, Zebrafish | |
Human, Mouse | |
Rabbit | |
Polyclonal | |
Unconjugated |
ELISA, IF, IHC-Fr, IHC-P, WB | |
Bovine, Human, Mouse, Porcine, Rabbit, Rat, Sheep | |
Human | |
Rabbit | |
Polyclonal | |
Unconjugated |
IF | |
Bovine, Human, Mouse, Porcine, Rabbit, Rat, Sheep | |
Rabbit | |
Polyclonal | |
PE |
ELISA, IHC-Fr, IHC-P, WB | |
Bovine, Human, Mouse, Porcine, Rabbit, Rat, Sheep | |
Rabbit | |
Polyclonal | |
HRP |
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a Review