Cart summary

You have no items in your shopping cart.

TOX4 Rabbit Polyclonal Antibody (Biotin)

TOX4 Rabbit Polyclonal Antibody (Biotin)

Catalog Number: orb2127922

DispatchUsually dispatched within 5-10 working days
$ 680.00
Catalog Numberorb2127922
CategoryAntibodies
DescriptionTOX4 Rabbit Polyclonal Antibody (Biotin)
ClonalityPolyclonal
Species/HostRabbit
ConjugationBiotin
Predicted ReactivityBovine, Canine, Equine, Goat, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish
Form/AppearanceLiquid. Purified antibody supplied in 1x PBS buffer.
Buffer/PreservativesLiquid. Purified antibody supplied in 1x PBS buffer.
ImmunogenThe immunogen is a synthetic peptide directed towards the C-terminal region of human TOX4
Protein SequenceSynthetic peptide located within the following region: RCVRSGCENPPIVSKDWDNEYCSNECVVKHCRDVFLAWVASRNSNTVVFV
UniProt IDB4DPY8
MW65kDa
Tested applicationsWB
StorageAll conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
Alternative namesLCP1, MIG7, C14orf92, KIAA0737
NoteFor research use only
NCBINP_001290452.1