You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb585143 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to TOM1L1 |
Target | TOM1L1 |
Clonality | Polyclonal |
Species/Host | Rabbit |
Conjugation | Unconjugated |
Reactivity | Human |
Predicted Reactivity | Rabbit, Rat |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Concentration | 0.5 mg/ml |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Protein Sequence | Synthetic peptide located within the following region: LNNAILGYERFTRNQQRILEQNKNQKEATNTTSEPSAPSQDLLDLSPSPR |
UniProt ID | O75674 |
MW | 52kDa |
Tested applications | WB |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Alternative names | SRCASM |
Note | For research use only |
NCBI | NP_005477 |
Rabbit Anti-TOM1L1 antibody, Formalin Fixed Paraffin Embedded Tissue: Human Liver, Primary antibody Concentration: 1:100, Secondary Antibody: Donkey anti-Rabbit-Cy3, Secondary Antibody Concentration: 1:200, Magnification: 20x, Exposure Time: 0.5-2.0 sec.
Rabbit Anti-TOM1L1 antibody, Formalin Fixed Paraffin Embedded Tissue: Human Spleen, Primary antibody Concentration: 1:100, Secondary Antibody: Donkey anti-Rabbit-Cy3, Secondary Antibody Concentration: 1:200, Magnification: 20x, Exposure Time: 0.5-2.0 sec.
WB Suggested Anti-TOM1L1 Antibody, Titration: 1.0 ug/ml, Positive Control: Fetal Brain.
WB | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
WB | |
Bovine, Canine, Guinea pig, Human, Rabbit, Rat | |
Mouse | |
Rabbit | |
Polyclonal | |
Unconjugated |