TNP1 Rabbit Polyclonal Antibody

• Catalog Number: orb325877
• Category: Antibodies
• Description: Rabbit polyclonal antibody to TNP1
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: WB
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Mouse, Porcine, Rabbit, Rat, Sheep
• Reactivity: Human
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human TNP1
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 6kDa
• Target: TNP1
• UniProt ID: P09430
• Protein Sequence: Synthetic peptide located within the following region: MSTSRKLKSHGMRRSKSRSPHKGVKRGGSKRKYRKGNLKSRKRGDDANRN
• NCBI: NP_003275
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: anti TP1 antibody
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Rabbit Anti-TNP1 / TP1 antibody, Catalog Number: orb325877, Formalin Fixed Paraffin Embedded Tissue: Human Adult Testis, Observed Staining: Cytoplasm in hepatocytes, Primary Antibody Concentration: 1:600, Secondary Antibody: Donkey anti-Rabbit-Cy3, Secondary Antibody Concentration: 1:200, Magnification: 20X, Exposure Time: 0.5 – 2.0 sec.

WB Suggested Anti-TNP1 Antibody Titration: 0.2-1 ug/mL, Positive Control: 721_B cell lysate.