You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb580260 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to Tnni3k |
Target | Tnni3k |
Clonality | Polyclonal |
Species/Host | Rabbit |
Conjugation | Unconjugated |
Reactivity | Mouse |
Predicted Reactivity | Bovine, Canine, Equine, Human, Rabbit, Rat, Zebrafish |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Concentration | 0.5 mg/ml |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Purification | Affinity Purified |
Protein Sequence | Synthetic peptide located within the following region: NLVACDPSRSSGEKDEQTCLMWAYEKGHDAIVTLLKHYKRPQDELPCNEY |
UniProt ID | B2RTJ7 |
MW | 92kDa |
Tested applications | WB |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Alternative names | Ca, Cark, D830019J24Rik |
Note | For research use only |
NCBI | NP_796040 |
Expiration Date | 12 months from date of receipt. |
WB Suggested Anti-Tnni3k Antibody, Titration: 1.0 ug/ml, Positive Control: Mouse Liver.
IHC, WB | |
Bovine, Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
IF, IHC-Fr, IHC-P | |
Bovine, Equine, Gallus, Mouse, Rabbit, Sheep | |
Human, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
IHC | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |