You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb580820 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to TNMD |
Target | TNMD |
Clonality | Polyclonal |
Species/Host | Rabbit |
Conjugation | Unconjugated |
Reactivity | Human, Mouse |
Predicted Reactivity | Bovine, Canine, Equine, Guinea pig, Porcine, Rabbit, Rat, Sheep, Zebrafish |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Concentration | 0.5 mg/ml |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human TNMD |
Protein Sequence | Synthetic peptide located within the following region: KKKIYMEIDPVTRTEIFRSGNGTDETLEVHDFKNGYTGIYFVGLQKCFIK |
UniProt ID | Q9H2S6 |
MW | 37 kDa |
Tested applications | WB |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Alternative names | TEM, CHM1L, BRICD4 |
Note | For research use only |
NCBI | NP_071427 |
25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 3 ug/ml of the antibody was used in this experiment. Peptide is present in the canonical 37 kDa protein, a slightly larger isoform of ~38 kDa, and also an isoform of 24 kDa. Protein is further glycosylated.
Sample Tissue: Mouse Testis, Antibody dilution: 1 ug/ml.
Sample Tissue: Human Fetal Liver, Antibody dilution: 1.0 ug/ml.
Sample Tissue: Human HT1080 Whole Cell, Antibody dilution: 1 ug/ml.
WB Suggested Anti-TNMD Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:62500, Positive Control: Human heart.
IF, IHC-Fr, IHC-P, WB | |
Bovine, Canine, Equine, Porcine, Rabbit, Sheep | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
IF, IHC-Fr, IHC-P, WB | |
Mouse, Rat | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
WB | |
Bovine, Canine, Equine, Guinea pig, Mouse, Porcine, Rabbit, Rat | |
Human | |
Rabbit | |
Polyclonal | |
Unconjugated |
IF | |
Bovine, Canine, Equine, Porcine, Rabbit, Sheep | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
FITC |