Tnks Rabbit Polyclonal Antibody

• Catalog Number: orb574897
• Category: Antibodies
• Description: Rabbit polyclonal antibody to Tnks
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: IHC, WB
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Zebrafish
• Reactivity: Rat
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 144kDa
• Target: Tnks
• UniProt ID: D3Z8Q6
• Protein Sequence: Synthetic peptide located within the following region: GADPTLVNCHGKSAVDMAPTPELRERLTYEFKGHSLLQAAREADLAKVKK
• NCBI: NP_001099554
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

WB Suggested Anti-Tnks Antibody, Titration: 1.0 ug/ml, Positive Control: Rat Lung.

Rabbit Anti-Tnks Antibody, Catalog Number: orb574897, Formalin Fixed Paraffin Embedded Tissue: Human Adult heart, Observed Staining: Cytoplasmic, Primary Antibody Concentration: 1:600, Secondary Antibody: Donkey anti-Rabbit-Cy2/3, Secondary Antibody Concentration: 1:200, Magnification: 20X, Exposure Time: 0.5-2.0 sec.