You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb574812 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to TNKS |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | IHC, WB |
Predicted Reactivity | Bovine, Canine, Equine, Guinea pig, Rabbit, Rat |
Reactivity | Human, Mouse |
Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human TNKS |
Concentration | 0.5 mg/ml |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Conjugation | Unconjugated |
MW | 142kDa |
Target | TNKS |
UniProt ID | O95271 |
Protein Sequence | Synthetic peptide located within the following region: LIKGVERLLGGQQGTNPYLTFHCVNQGTILLDLAPEDKEYQSVEEEMQST |
NCBI | NP_003738 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Alternative names | TIN1, ARTD5, PARPL, TINF1, TNKS1, pART5, PARP5A, P Read more... |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
HepG2
Sample Tissue: Mouse Spleen, Antibody dilution: 1 ug/ml.
WB Suggested Anti-TNKS Antibody Titration: 1 ug/ml, Positive Control: 721_B cell lysate, TNKS is strongly supported by BioGPS gene expression data to be expressed in Human 721_B cells.
IHC, WB | |
Bovine, Canine, Equine, Guinea pig, Rabbit, Rat | |
Human, Mouse | |
Rabbit | |
Polyclonal | |
Unconjugated |
IHC, WB | |
Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Zebrafish | |
Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |