TNKS Rabbit Polyclonal Antibody

• Catalog Number: orb574812
• Category: Antibodies
• Description: Rabbit polyclonal antibody to TNKS
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: IHC, WB
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Rabbit, Rat
• Reactivity: Human, Mouse
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human TNKS
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 142kDa
• Target: TNKS
• UniProt ID: O95271
• Protein Sequence: Synthetic peptide located within the following region: LIKGVERLLGGQQGTNPYLTFHCVNQGTILLDLAPEDKEYQSVEEEMQST
• NCBI: NP_003738
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: TIN1, ARTD5, PARPL, TINF1, TNKS1, pART5, PARP5A, P
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

HepG2

Sample Tissue: Mouse Spleen, Antibody dilution: 1 ug/ml.

WB Suggested Anti-TNKS Antibody Titration: 1 ug/ml, Positive Control: 721_B cell lysate, TNKS is strongly supported by BioGPS gene expression data to be expressed in Human 721_B cells.