You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb584859 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to TNFSF13 |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | WB |
Predicted Reactivity | Bovine, Canine, Equine, Goat, Porcine, Rabbit, Rat |
Reactivity | Human |
Concentration | 0.5 mg/ml |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Conjugation | Unconjugated |
MW | 16kDa |
Target | TNFSF13 |
UniProt ID | O75888 |
Protein Sequence | Synthetic peptide located within the following region: EQSSDALEAWENGERSRKRRAVLTQKQKKQHSVLHLVPINATSKDDSDVT |
NCBI | NP_003799 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Alternative names | APRIL, CD256, TALL2, ZTNF2, TALL-2, TNLG7B, TRDL-1 Read more... |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
WB Suggested Anti-TNFSF13 Antibody, Titration: 1.0 ug/ml, Positive Control: HCT15 Whole Cell. TNFSF13 is strongly supported by BioGPS gene expression data to be expressed in Human HCT15 cells.
IF, IH, WB | |
Human, Mouse, Porcine, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
ELISA, IF, IHC-P, WB | |
Human, Mouse, Rat | |
Polyclonal | |
Unconjugated |
IF, IHC-P, WB | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
FC | |
Mouse, Rat | |
Human | |
Rabbit | |
Polyclonal | |
Unconjugated |