TNFSF13 Rabbit Polyclonal Antibody

• Catalog Number: orb584859
• Category: Antibodies
• Description: Rabbit polyclonal antibody to TNFSF13
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: WB
• Predicted Reactivity: Bovine, Canine, Equine, Goat, Porcine, Rabbit, Rat
• Reactivity: Human
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 16kDa
• Target: TNFSF13
• UniProt ID: O75888
• Protein Sequence: Synthetic peptide located within the following region: EQSSDALEAWENGERSRKRRAVLTQKQKKQHSVLHLVPINATSKDDSDVT
• NCBI: NP_003799
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: APRIL, CD256, TALL2, ZTNF2, TALL-2, TNLG7B, TRDL-1
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

WB Suggested Anti-TNFSF13 Antibody, Titration: 1.0 ug/ml, Positive Control: HCT15 Whole Cell. TNFSF13 is strongly supported by BioGPS gene expression data to be expressed in Human HCT15 cells.