Cart summary

You have no items in your shopping cart.

TMEM9 Rabbit Polyclonal Antibody (Biotin)

TMEM9 Rabbit Polyclonal Antibody (Biotin)

Catalog Number: orb2115949

DispatchUsually dispatched within 5-10 working days
$ 680.00
Catalog Numberorb2115949
CategoryAntibodies
DescriptionTMEM9 Rabbit Polyclonal Antibody (Biotin)
Species/HostRabbit
ClonalityPolyclonal
Tested applicationsWB
Predicted ReactivityBovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish
ImmunogenThe immunogen is a synthetic peptide directed towards the C terminal region of human TMEM9
Form/AppearanceLiquid. Purified antibody supplied in 1x PBS buffer.
ConjugationBiotin
MW20kDa
UniProt IDQ9P0T7
Protein SequenceSynthetic peptide located within the following region: DARSMAAAAASLGGPRANTVLERVEGAQQRWKLQVQEQRKTVFDRHKMLS
NCBINP_057540
StorageAll conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
Buffer/PreservativesLiquid. Purified antibody supplied in 1x PBS buffer.
Alternative namesDERM4, TMEM9A
Read more...
NoteFor research use only
Expiration Date12 months from date of receipt.