Tmem86a Rabbit Polyclonal Antibody

• Catalog Number: orb325830
• Category: Antibodies
• Description: Rabbit polyclonal antibody to Tmem86a
• Target: Tmem86a
• Clonality: Polyclonal
• Species/Host: Rabbit
• Conjugation: Unconjugated
• Reactivity: Mouse
• Predicted Reactivity: Bovine, Equine, Guinea pig, Human, Rabbit, Rat, Zebrafish
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Mouse Tmem86a
• Protein Sequence: Synthetic peptide located within the following region: MVSPVTVVKSEGPKLVPFFKATCVYFVLWLPSSSPSWVSALIKCLPIFCL
• UniProt ID: Q9D8N3
• MW: 27kDa
• Tested applications: WB
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Alternative names: anti 1810054O13Rik antibody, anti AI414959 antibod
• Note: For research use only
• NCBI: NP_080712

Sample Type: Mouse Testis lysates, Antibody Dilution: 1.0 ug/mL.