Tmem86a antibody

• Catalog Number: orb325830
• Category: Antibodies
• Description: Rabbit polyclonal antibody to Tmem86a
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: WB
• Predicted Reactivity: Animal, Bovine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish
• Reactivity: Equine, Guinea pig, Human, Mouse, Rat, Zebrafish
• Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Mouse Tmem86a
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 27kDa
• Target: Tmem86a
• UniProt ID: Q9D8N3
• Protein Sequence: Synthetic peptide located within the following region: MVSPVTVVKSEGPKLVPFFKATCVYFVLWLPSSSPSWVSALIKCLPIFCL
• NCBI: NP_080712
• Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -2°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: anti 1810054O13Rik antibody, anti AI414959 antibod
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Western blot analysis of mouse Testis tissue using Tmem86a antibody