TMEM42 antibody

• Catalog Number: orb325774
• Category: Antibodies
• Description: Rabbit polyclonal antibody to TMEM42
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: WB
• Predicted Reactivity: Canine, Guinea pig, Human, Rabbit
• Reactivity: Canine, Guinea pig, Human
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human TMEM42
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 17kDa
• Target: TMEM42
• UniProt ID: Q5R7Q1
• Protein Sequence: Synthetic peptide located within the following region: MAERPGPPGGAVSATAYPDTPAEFPPHLQAGAMRRRFWGVFNCLCAGAFG
• NCBI: NP_653239
• Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -2°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: anti MGC29956 antibody
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Western blot analysis of ACHN cell lysate tissue using TMEM42 antibody