TMEM38B Rabbit Polyclonal Antibody

• Catalog Number: orb580042
• Category: Antibodies
• Description: Rabbit polyclonal antibody to TMEM38B
• Target: TMEM38B
• Clonality: Polyclonal
• Species/Host: Rabbit
• Conjugation: Unconjugated
• Reactivity: Human
• Predicted Reactivity: Human
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Affinity Purified
• Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human TMEM38B
• Protein Sequence: Synthetic peptide located within the following region: WMLFGWQQPFSSCEKKSEAKSPSNGVGSLASKPVDVASDNVKKKHTKKNE
• UniProt ID: Q9NVV0
• MW: 32kDa
• Tested applications: WB
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Alternative names: OI14, TRICB, TRIC-B, C9orf87, D4Ertd89e, bA219P18.
• Research Area: Cell Biology
• Note: For research use only
• NCBI: NP_060582

WB Suggested Anti-TMEM38B Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:312500, Positive Control: Hela cell lysate.