TMEM26 Rabbit Polyclonal Antibody

• Catalog Number: orb327119
• Category: Antibodies
• Description: Rabbit polyclonal antibody to TMEM26
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: WB
• Predicted Reactivity: Human
• Reactivity: Human
• Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Human TMEM26
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 40kDa
• Target: TMEM26
• UniProt ID: Q6ZUK4
• Protein Sequence: Synthetic peptide located within the following region: RSQSEGLKGEHGCRAQTSESGPSQRDWQNESKEGLAIPLRGSPVTSDDSH
• NCBI: NP_848600
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Sample Type: COLO205 Whole Cell lysates, Antibody Dilution: 1.0 ug/mL.

Positive control (+): Human Kidney (KI), Negative control (-): Human Fetal Heart (HE), Antibody concentration: 1 ug/mL.

Rabbit Anti-TMEM26 Antibody, Catalog Number: orb327119, Formalin Fixed Paraffin Embedded Tissue: Human Human Colon Tissue, Observed Staining: Plasma membrane, Cytoplasm, Primary Antibody Concentration: 1:100, Other Working Concentrations: 1:600, Secondary Antibody: Donkey anti-Rabbit-Cy3, Secondary Antibody Concentration: 1:200, Magnification: 20X, Exposure Time: 0.5 - 2.0 sec.