TMEM236 Rabbit Polyclonal Antibody

• Catalog Number: orb327167
• Category: Antibodies
• Description: Rabbit polyclonal antibody to TMEM236
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: WB
• Predicted Reactivity: Bovine, Equine, Guinea pig
• Reactivity: Human
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of Human TMEM236
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 38kDa
• Target: TMEM236
• UniProt ID: Q5W0B7
• Protein Sequence: Synthetic peptide located within the following region: YPLRGSQKSSENGHIHSTSLQHIKTVTEQVRQSPENAASPQATNSTQVSQ
• NCBI: XP_003959978
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: FAM23A, FAM23B, bA16O1.2, bA162I21.2
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Sample Tissue: Human COLO205 Whole Cell, Antibody Dilution: 1 ug/mL.