You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb327167 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to TMEM236 |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | WB |
Predicted Reactivity | Bovine, Equine, Guinea pig |
Reactivity | Human |
Immunogen | The immunogen is a synthetic peptide directed towards the middle region of Human TMEM236 |
Concentration | 0.5 mg/ml |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Conjugation | Unconjugated |
MW | 38kDa |
Target | TMEM236 |
UniProt ID | Q5W0B7 |
Protein Sequence | Synthetic peptide located within the following region: YPLRGSQKSSENGHIHSTSLQHIKTVTEQVRQSPENAASPQATNSTQVSQ |
NCBI | XP_003959978 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Alternative names | FAM23A, FAM23B, bA16O1.2, bA162I21.2 Read more... |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
Sample Tissue: Human COLO205 Whole Cell, Antibody Dilution: 1 ug/mL.
WB | |
Bovine, Equine, Guinea pig, Human | |
Rabbit | |
Polyclonal | |
HRP |