Cart summary

You have no items in your shopping cart.

TMEM176A Rabbit Polyclonal Antibody (FITC)

TMEM176A Rabbit Polyclonal Antibody (FITC)

Catalog Number: orb2120562

DispatchUsually dispatched within 5-10 working days
$ 680.00
Catalog Numberorb2120562
CategoryAntibodies
DescriptionTMEM176A Rabbit Polyclonal Antibody (FITC)
Species/HostRabbit
ClonalityPolyclonal
Tested applicationsWB
Predicted ReactivityEquine, Human
ImmunogenThe immunogen is a synthetic peptide directed towards the middle region of human TMEM176A
Form/AppearanceLiquid. Purified antibody supplied in 1x PBS buffer.
ConjugationFITC
MW26kDa
UniProt IDQ96HP8
Protein SequenceSynthetic peptide located within the following region: GYSYYNSACRISSSSDWNTPAPTQSPEEVRRLHLCTSFMDMLKALFRTLQ
NCBINP_060957
StorageAll conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
Buffer/PreservativesLiquid. Purified antibody supplied in 1x PBS buffer.
Alternative namesGS188, MS4B1, HCA112
Read more...
NoteFor research use only
Expiration Date12 months from date of receipt.