Cart summary

You have no items in your shopping cart.

Tmem164 Rabbit Polyclonal Antibody (FITC)

Tmem164 Rabbit Polyclonal Antibody (FITC)

Catalog Number: orb2097261

DispatchUsually dispatched within 5-10 working days
$ 680.00
Catalog Numberorb2097261
CategoryAntibodies
DescriptionTmem164 Rabbit Polyclonal Antibody (FITC)
ClonalityPolyclonal
Species/HostRabbit
ConjugationFITC
Predicted ReactivityBovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat
Form/AppearanceLiquid. Purified antibody supplied in 1x PBS buffer.
Buffer/PreservativesLiquid. Purified antibody supplied in 1x PBS buffer.
Protein SequenceSynthetic peptide located within the following region: QQVTQRPEEGKESLSKNLLLVALCLIFGVEVGFKFATKTVIYLLNPCHLV
UniProt IDQ6PHN7
MW33kDa
Tested applicationsWB
StorageAll conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
Alternative namesAI316850, AI852450, AW547186, F730011B02
NoteFor research use only
NCBINP_808260