You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb325471 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to TMEM126B |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | WB |
Predicted Reactivity | Canine, Human, Rabbit |
Reactivity | Canine, Human |
Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human TMEM126B |
Concentration | 0.5 mg/ml |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Conjugation | Unconjugated |
MW | 23kDa |
Target | TMEM126B |
UniProt ID | Q8IUX1 |
Protein Sequence | Synthetic peptide located within the following region: AASMHGQPSPSLEDAKLRRPMVIEIIEKNFDYLRKEMTQNIYQMATFGTT |
NCBI | NP_060950 |
Storage | For short term use, store at 2-8C up to 1 week. For long term storage, store at -2°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Alternative names | anti HT007 antibody, anti MGC111203 antibody Read more... |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
Western blot analysis of MCF7 cell lysate tissue using TMEM126B antibody
WB | |
Animal, Bovine, Canine, Guinea pig, Human, Mouse, Rabbit, Rat | |
Canine, Equine, Guinea pig, Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
Filter by Rating