Cart summary

You have no items in your shopping cart.

TMC3 Rabbit Polyclonal Antibody (FITC)

TMC3 Rabbit Polyclonal Antibody (FITC)

Catalog Number: orb2088843

DispatchUsually dispatched within 5-10 working days
$ 680.00
Catalog Numberorb2088843
CategoryAntibodies
DescriptionTMC3 Rabbit Polyclonal Antibody (FITC)
Species/HostRabbit
ClonalityPolyclonal
Predicted ReactivityCanine, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish
ImmunogenThe immunogen is a synthetic peptide directed towards the following sequence YPQPPLKPRGKPRFEPSLTESDSVSAASSSDQQNSSADQYLQVTHSQGRF
Form/AppearanceLiquid. Purified antibody supplied in 1x PBS buffer.
ConjugationFITC
MW126 kDa
UniProt IDQ7Z5M5
Protein SequenceSynthetic peptide located within the following region: YPQPPLKPRGKPRFEPSLTESDSVSAASSSDQQNSSADQYLQVTHSQGRF
NCBINP_001074001
StorageAll conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
Buffer/PreservativesLiquid. Purified antibody supplied in 1x PBS buffer.
NoteFor research use only
Expiration Date12 months from date of receipt.